PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29737.m001227
Common NameRCOM_0700880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family ARR-B
Protein Properties Length: 676aa    MW: 74391.1 Da    PI: 6.339
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29737.m001227genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.85.9e-29206259155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kpr++W+ eLH++Fv av+qL G +kA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  29737.m001227 206 KPRVVWSVELHRKFVAAVNQL-GLDKAVPKKILDLMNVEGLTRENVASHLQKYRL 259
                    79*******************.********************************8 PP

2Response_reg85.71.4e-28201281109
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    vl vdD+p+ +++l ++l+k +y +v+++ ++ +al++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah+++e++ + +  Ga
  29737.m001227  20 VLAVDDDPICLKVLDTLLKKCQY-QVTTTNQAIQALKMLRENRnkYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDKELVYKGVTHGA 113
                    799********************.***************999889*******************87754.558*********************** PP

                    SEEEESS--HHHHHH CS
   Response_reg  95 kdflsKpfdpeelvk 109
                     d+l Kp+ +eel +
  29737.m001227 114 VDYLLKPVRIEELKN 128
                    ************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.6E-1661675IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.2E-4317152No hitNo description
SuperFamilySSF521724.13E-3717146IPR011006CheY-like superfamily
SMARTSM004482.0E-3418130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.38419134IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.3E-2620128IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.28E-3021134No hitNo description
Gene3DG3DSA:1.10.10.608.9E-31203264IPR009057Homeodomain-like
PROSITE profilePS5129412.009203262IPR017930Myb domain
SuperFamilySSF466895.91E-20204263IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-25206259IPR006447Myb domain, plants
PfamPF002491.1E-7208258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016310Biological Processphosphorylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MTVEDKRSSS EDKFPVGMRV LAVDDDPICL KVLDTLLKKC QYQVTTTNQA IQALKMLREN  60
RNKYDLVISD VNMPDMDGFK LLELVGLEMD LPVIMLSAHS DKELVYKGVT HGAVDYLLKP  120
VRIEELKNIW QHVIRRKKLQ PKDQSRSQNQ DKPLDGAGEG GQGMSSSGSE DQNGKVNRKR  180
KDQDEDEEEE GEDNLNDTDE PGAQKKPRVV WSVELHRKFV AAVNQLGLDK AVPKKILDLM  240
NVEGLTRENV ASHLQKYRLY LKRISSTASQ QANMVAAFGI KDSSYLRMAS LDGFGEFRTL  300
SGPGRLSSTS ISSYHPSGML GRLNSPSGLT LRGIASSGLL QPGQSQSLSS SVNTLGKLQP  360
TLLHSSQGVN LFQGIPSSLE PNQLQSKSSA HFGEFNRNDD SSGFSLTNSF SDARVTIGSL  420
SNTATGPSSN PMMLQAHPQQ NQNTGVFATQ SSLSVPSLNQ ESFDVGVRGS SNFLDHSRCN  480
ESWQGAVQLS KFSTTLPLSE PFSHDALSTS NFRDNMSSTN SRMVNSPTDY SSSAVLASPL  540
DTRVDMQGQT GFAGNVVQST SYNSRQRWEE HGQDYNPNLS NSFSTINPLV SGNGVLGSLS  600
HCIDRSKKFD APLVGQSPSS FQQAEVEKSP LEPKMRSNED YLLEQTKSQN GYESLDDIMN  660
AMIKRVWSNV FLCYLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-25203265264ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002523510.20.0PREDICTED: two-component response regulator ARR12 isoform X1
RefseqXP_015577477.10.0PREDICTED: two-component response regulator ARR12 isoform X2
SwissprotQ6K8X61e-143ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLB9SBZ10.0B9SBZ1_RICCO; Two-component system sensor histidine kinase/response regulator, putative
STRINGPOPTR_0018s11960.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-127response regulator 12